PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F04277.1.p
Common NameEUGRSUZ_F04277
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 307aa    MW: 34261.4 Da    PI: 9.9362
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F04277.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85e-182570147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                      rg W + Ede+l ++v+q+G ++W++Ia++++ gR++k+c++rw++ 
  Eucgr.F04277.1.p 25 RGHWRPAEDEKLRQLVRQYGAHNWNAIAEKLQ-GRSGKSCRLRWFNQ 70
                      899*****************************.***********996 PP

2Myb_DNA-binding58.12e-1877120146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       r ++T++E+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ 
  Eucgr.F04277.1.p  77 RRPFTEDEEERLLAAHRVHGNR-WALIARLFP-GRTDNAVKNHWHV 120
                       679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9452071IPR017930Myb domain
SuperFamilySSF466895.62E-2924118IPR009057Homeodomain-like
SMARTSM007173.5E-152473IPR001005SANT/Myb domain
PfamPF002493.0E-172570IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.2E-272678IPR009057Homeodomain-like
CDDcd001672.32E-142869No hitNo description
PROSITE profilePS5129427.70972126IPR017930Myb domain
SMARTSM007179.2E-1676124IPR001005SANT/Myb domain
PfamPF002493.1E-1577119IPR001005SANT/Myb domain
CDDcd001672.11E-1279119No hitNo description
Gene3DG3DSA:1.10.10.604.6E-2179125IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDNSRPNKLG GGGSGSGDEG KACTRGHWRP AEDEKLRQLV RQYGAHNWNA IAEKLQGRSG  60
KSCRLRWFNQ LDPRINRRPF TEDEEERLLA AHRVHGNRWA LIARLFPGRT DNAVKNHWHV  120
IMARKQREES RLLPSYKRSY QDSLIDFKGL HGIGKSAFVV QPSSNYGLEK KQDRHFDSSL  180
LPWKFAPSVS AAMAPPASFL VGLARGEKRD YSASGFCDCT WESYQSLNNN LPSYAALALP  240
NYASPLKYPR HGNDYEATQM IRKNDGDPRD SLANANMMAA GQGGGNESIV RKDVPFIDFL  300
GVGITS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32241256107B-MYB
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F04277.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063899.10.0PREDICTED: transcription factor MYB21-like
TrEMBLA0A059BZT10.0A0A059BZT1_EUCGR; Uncharacterized protein
STRINGPOPTR_0005s20870.13e-87(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM101332036
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-68myb domain protein 52